CK-BB (CKBB, Creatine Kinase B-type, B-CK, Creatine Kinase B Chain, CKB)

Größe

£685.00

SKU:: 125015
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-381 from human CKB (AAH01190) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D5-3D11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Creatine Kinase (CK) is a dimeric enzyme composed of either M- or B-type subunits. The resulting isoenzymes are expressed at varying levels in different tissues. CK-BB, a cytoplasmic predominantly found in brain tissues, participates in energy homeostasis, reversibly catalyzing the transfer of a phosphate group between ATP and target proteins such as a creatine phosphate. CK-BB exists in normally neglible amounts in the serum of adults, overexpression of CK-BB is associated with cancers of the breast, ovary, prostate, colon, and in small-cell lung cancer. Global assessment of changes in serum levels of CK-BB, CK-MB and CK-MM, are used as a marker for myocardial infarction. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice