125006-ML550
CIKS (Connection to IKK and SAPK/JNK, ACT1, Adapter Protein CIKS, C6orf2, C6orf4, C6orf5, C6orf6, DKFZP586G0522, MGC3581, Nuclear Factor NF-kappa-B Activator 1, TRAF3 Interacting Protein 2, TRAF3IP2) (MaxLight 550)
Größe
£914.00
- SKU:
- 125006-ML550
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa451-565 from human TRAF3IP2 (AAH02823) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4A3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Weitere Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. Nuclear factor kappa B (NF-kB) is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kB mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kB associates with IkB proteins in the cell cytoplasm, which inhibit NF-kB activity. IkB is phosphorylated by IkB kinase (IKK) complex that contains IKKa, IKKb, and IKKg. A novel molecule that associates with and activates IKK was recently identified and designated CIKS (for connection to IKK and SAPK/JNK) and Act1 (for NF-kB activator 1). CIKS directly interacts with IKKg. CIKS/Act1 also activates activating transcription factor (ATF) and activator protein 1 (AP-1) through Jun kinase (JNK). These results indicate that CIKS/Act1 is involved in the inflammation and stress responses. CIKS/Act1 is ubiquitously expressed in human tissues. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice