124976-ML650
CHRNA5 (Neuronal Acetylcholine Receptor Subunit alpha-5, NACHRA5) (MaxLight 650)
Größe
£914.00
- SKU:
- 124976-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa38-131 from human CHRNA5 (NP_000736) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 7D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Nicotinic acetylcholine receptors, also known as nAChRs, belong to a family of proteins called ligand gated ion channels and are widely expressed throughout the nervous system. nAChRs are made up of 5 subunits (two alpha and three beta). Nicotinic Acetylcholine Receptor a5 has an ax ay beta combination. In the CNS, the a5 subunit is widely expressed in the CA1 area of the hippocampus which affects learning, memory, attention, anxiety, and potentially drug seeking behaviors. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice