124976-BIOTIN
CHRNA5 (Neuronal Acetylcholine Receptor Subunit alpha-5, NACHRA5) (Biotin)
Größe
£927.00
- SKU:
- 124976-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa38-131 from human CHRNA5 (NP_000736) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 7D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- Nicotinic acetylcholine receptors, also known as nAChRs, belong to a family of proteins called ligand gated ion channels and are widely expressed throughout the nervous system. nAChRs are made up of 5 subunits (two alpha and three beta). Nicotinic Acetylcholine Receptor a5 has an ax ay beta combination. In the CNS, the a5 subunit is widely expressed in the CA1 area of the hippocampus which affects learning, memory, attention, anxiety, and potentially drug seeking behaviors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice