CHMP2A (Chromatin Modifying Protein 2A, BC2, BC-2, Charged multivesicular body protein 2a, CHMP2, CHMP2a, Chromatin-modifying protein 2a, hVps2-1, Vacuolar protein-sorting-associated protein 2-1, VPS2, Vps2-1, VPS2A)

Größe

£685.00

SKU:: 124957
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human CHMP2A, aa1-222 (AAH02502).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CHMP2A, also known as chromatin modifying protein 2A, belongs to the SNF7 family and it is component of the ESCRT III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.