124931-ML650
CHEK1 (Serine/Threonine-protein Kinase Chk1, CHK1 Checkpoint Homolog, Cell Cycle Checkpoint Kinase, Checkpoint Kinase-1, CHK1) (MaxLight 650)
Größe
£914.00
- SKU:
- 124931-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa361-476 from human CHEK1 (AAH04202) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. The checkpoint kinases Chk1 is a serine/threonine kinase involved in the signal transduction mechanisms of the DNA damage response pathways in response to the activation of upstream kinases. In mammals, Chk1 is mainly regulated by the ATR kinase. Activated Chk1 phosphorylates and regulates different downstream targets, such as p53 and CDC25 phosphatases, promoting cell cycle arrest at G1/S and G2/M boundaries after DNA damage, and also S phase delay and inhibition of replication origin firing when DNA replication is blocked. Different studies showed Chk1 frameshift mutations in endometrial, colorectal, and stomach carcinomas with microsatellite instability. Applications: Suitable for use in Immunofluorescence and FLISA. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice