CHD4 (Chromodomain-helicase-DNA-binding Protein 4, CHD-4, ATP-dependent Helicase CHD4, Mi-2 Autoantigen 218kD Protein, Mi2-beta)

Größe

£685.00

SKU:: 124927
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1632-1730 from human CHD4 (NP_001264) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. Patients with dermatomyositis develop antibodies against the nuclear antigen chromodomain helicase DNA binding protein 4. The protein exists in a complex containing histone deacetylase and nucleosome remodeling activities, suggesting a role for chromatin reorganization in cancer metastasis. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.