CHD3 (Chromodomain-helicase-DNA-binding Protein 3, CHD-3, ATP-dependent Helicase CHD3, Mi-2 Autoantigen 240kD Protein, Mi2-alpha, Zinc Finger Helicase, hZFH)

Größe

£685.00

SKU:: 124926
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1654-1741 from human CHD3 (NP_001005273) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 5E12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Required for anchoring centrosomal pericentrin in both interphase and mitosis, for spindle organization and centrosome integrity. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.