CHAF1A (Chromatin Assembly Factor 1 Subunit A, CAF-1 Subunit A, Chromatin Assembly Factor I p150 Subunit, CAF-I 150kD Subunit, CAF-I p150, hp150, CAF, CAF1P150)

Größe

£685.00

SKU:: 124921
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa21-120 from CHAF1A (AAH67093) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Chromatin assembly factor I (CAF1) is a nuclear complex consisting of p50, p60 (CHAF1B; MIM 601245), and p150 (CHAF1A) subunits that assembles histone octamers onto replicating DNA in vitro (Kaufman et al., 1995 [PubMed 7600578]). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.