CGB5 (Choriogonadotropin Subunit beta, CG-beta, Chorionic Gonadotrophin Chain beta, CGB, CGB3, CGB7, CGB8)

Größe

£685.00

SKU:: 124912
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant protein corresponding to aa1-165 from human CGB5 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. Applications: Suitable for use in ELISA and Western Blot. Other applications have not been tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.