CFLAR (CASP8 and FADD-like Apoptosis Regulator, Caspase Homolog, CASH, Caspase-eight-related Protein, Casper, Caspase-like Apoptosis Regulatory Protein, CLARP, Cellular FLICE-like Inhibitory Protein, c-FLIP, FADD-like Antiapoptotic Molecule 1, FLAME-1, Inhibitor of FLICE, I-FLICE, MACH-related Inducer of Toxicity, MRIT, Usurpin, CASH, CASP8AP1, CLARP, MRIT)

Größe

£685.00

SKU:: 124906
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa178-277 from CFLAR (AAH01602) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2F12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice