CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon) (FITC)

Größe

£934.00

SKU:: 124828-FITC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CEBPE, aa1-281 (NP_001796.2).
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Weitere Details:: CCAAT-enhancer binding protein epsilon (CEBP e) is a 32kD basic-leucine zipper transcription factor that is expressed in myeloblasts, granulocytes, and eosinophils. Multiple isoforms of human CEBP e are generated by alternate splicing and alternative translation initiation sites. All four isoforms contain the bZIP domain (aa208-267) but exert different effects on myeloid differentiation. Full length CEBP e and the 30kD isoform (aa33-281) cooperate with c-Myb to activate the transcription of genes involved in myeloid differentiation. The 27kD isoform (which lacks aa69-97) and the 14kD isoform (which begins at aa153) function as transcriptional repressors in eosinophils. Within aa151-210, human CEBP e shares 93aa sequence identity with mouse and rat CEBP e, respectively. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice