124826-APC

CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (APC)

Größe

£927.00

SKU:: 124826-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa156-265 from human CEACAM6 (NP_002474) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1G2
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: CEA-related cell adhesion molecule 6 (CEACAM6, NCA) belongs to the carcinoembryonic antigen (CEA) gene family. It encodes a glycosyl phosphatidyl inositol GPI)-linked glycoprotein with a Mr of 90kD which is strongly expressed on epithelial cells of the fetal and adult gastrointestinal tract, epithelia of glandular tissues, squamous epithelial cell of the tongue, esophagus and cervix as well as on granulocytes. CEACAM6 expression is upregulated in many adenocarcinomas and leukemias. Like all members of the CEA family, it consists of a single N domain, with structural homology to the immunoglobulin variable domains, followed by one immunoglobulin constant-like A and B domain. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Versandbedingungen:: Blue Ice