124819-APC
CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) (APC)
Größe
£927.00
- SKU:
- 124819-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa71-170 from human CDX4 (NP_005184.1) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F3
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- Caudal type homeo box transcription factor 4 (CDX4) is a member of the caudal-type homeobox genes which are candidates for directing tissue and organ development and differentiation. CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. CDX4 is located within the minimal region assigned to XIC in humans and furthermore, CDX4 is the closest known gene to XIST in both mouse and human. Unlike Xist, CDX4 appears to be normally X-inactivated in mice and it is not clear yet whether the location of this gene within the XIC region is of any significance in X-inactivation. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice