124817-BIOTIN
CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1) (Biotin)
Größe
£927.00
- SKU:
- 124817-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa126-215 from human CDX1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2D8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The caudal type homeo box transcription factor 1 (CDX1) and CDX2 are candidates for directing intestinal development, differentiation, and maintenance of the intestinal phenotype. CDX1 is a 265aa protein with 85% identity to mouse Cdx1 (98% identity, including conservative aa changes). CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. Decrease in human CDX1 and/or CDX2 expression is associated with colorectal tumorigenesis. On the other hand, increased CDX1 expression is associated with chronic atrophic gastritis. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice