CDS2 (Phosphatidate Cytidylyltransferase 2, CDP-DAG Synthase 2, CDP-DG Synthase 2, CDP-diacylglycerol Synthase 2, CDS 2, CDP-diglyceride Pyrophosphorylase 2, CDP-diglyceride Synthase 2, CTP:Phosphatidate Cytidylyltransferase 2)

Größe

£685.00

SKU:: 124816
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-68 from CDS2 (NP_003809) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May act cooperatively with GRB10 to regulate tyrosine kinase receptor signaling. May increase IGF1 receptor phosphorylation under IGF1 stimulation as well as phosphorylation of IRS1 and SHC1 (By similarity). Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.