124814
CDR2 (Cerebellar Degeneration-related Protein 2, Paraneoplastic Cerebellar Degeneration-associated Antigen, Major Yo Paraneoplastic Antigen, PCD17) (Not for Export EU)
Größe
£760.00
- SKU:
- 124814
- Anwendung:
- WB
- Reinheit:
- Serum
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CDR2, aa1-454 (NP_001793.1).
- Format:
- Supplied as a liquid.
- Weitere Details:
- CDR2 (Cerebellar degeneration related protein 2) is an onconeuronal antigen; i.e. an antigen that is expressed by systemic tumors and elicits an immune response that may develop into an autoimmune neuronal degeneration. Paraneoplastic cerebellar degeneration (PCD) is a disorder in which breast or ovarian tumors express CDR2, which normally is expressed in cerebellar Purkinje neurons. Patients with PCD carry a characteristic antibody called anti-Yo. Anti-Yo sera reacts with at least 2 antigens, a major species CDR2, and a minor species CDR1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLAENLVEEFEMKEDEPWYDHQDLQQDLQLAAELGKTLLDRNTELEDSVQQMYTTNQEQLQEIEYLTKQVELLRQMNEQHAKVYEQLDVTARELEETNQKLVADSKASQQKILSLTETIECLQTNIDHLQSQVEELKSSGQGRRSPGKCDQEKPAPSFACLKELYDLRQHFVYDHVFAEKITSLQGQPSPDEEENEHLKKTVTMLQAQLSLERQKRVTMEEEYGLVLKENSELEQQLGATGAYRARALELEAEVAEMRQMLQSEHPFVNGVEKLVPDSLYVPFKEPSQSLLEEMFLTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWELASVNPEPVSSPTTPPEYKALFKEIFSCIKKTKQEIDEQRTKYRSLSSHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice