CDK5 (Cyclin-Dependent Kinase 5, Cell Division Protein Kinase 5, Serine/Threonine-protein Kinase PSSALRE, Tau Protein Kinase II Catalytic Subunit, TPKII Catalytic Subunit)

Größe

£760.00

SKU:: 124788
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CDK5, aa1-292 (NP_004926.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cdk5 is ubiquitously expressed, but expression and activity is highest in post mitotic neurones, where p35 and p39 are highly expressed. Deregulation of this kinase is neurotoxic and might contribute to the pathogenesis of Alzheimer's disease and other neurodegenerative disorders. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.