CDK4 (Cyclin-dependent Kinase 4, Cell Division Protein Kinase 4, PSK-J3)

Größe

£685.00

SKU:: 124783
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length human CDK4, aa1-303 (NP_000066).
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cyclin-dependent kinase 4 (Cdk4) is a 34kD catalytic subunit of the protein kinase complex and belongs to the Ser/Thr protein kinase family. Cdk4 forms a complex with D-type cyclins and may regulate cell growth during G1 phase of the cell cycle. Cdk4 also associates with Cdk inhibitor p16 that down-regulates Cdk4 activity. Mutations in Cdk4 are associated with tumorigenesis of a variety of cancers. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.