CDH11 (Cadherin 11, Cadherin-11, OSF-4, Osteoblast Cadherin, OB-cadherin)

Größe

£685.00

SKU:: 124764
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa509-617 from human CDH11 (NP_001788) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PIVTISADDKDDTANGPRFIFSLPPEIIHNPNFTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGALLSCNAEAYILNAGLST Note: Applications are based on unconjugated antibody.