CDC42BPG (Serine/Threonine-protein Kinase MRCK gamma, CDC42-binding Protein Kinase gamma, DMPK-like gamma, Myotonic Dystrophy Kinase-related CDC42-binding Kinase gamma, MRCK gamma, MRCKG, Myotonic Dystrophy Protein Kinase-like gamma, Myotonic Dystrophy Protein Kinase-like alpha, DMPK2)

Größe

£685.00

SKU:: 124750
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1423-1529 from human CDC42BPG (NP_059995) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May act as a downstream effector of CDC42 in cytoskeletal reorganization. Contributes to the actomyosin contractility required for cell invasion, through the regulation of MYPT1 and thus MLC2 phosphorylation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.