124734-ML650
CDC25A (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A) (MaxLight 650)
Größe
£914.00
- SKU:
- 124734-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa151-250 from human CDC25A with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3D5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. CDC25A, a CDC25 dual specificity protein phosphatase, has been shown to activate the cyclin-dependent kinases at different points of the cell cycle. CDC25A has been shown to affect S phase entry and possibly the initiation of mitosis. CDC25A dephosphorylates cyclin dependent kinases, including Cdk2, Cdk4, as well as non cyclin proteins such as the homeodomain transcription factor cut, the proto-oncogene Raf-1. CDC25A has been implicated in many carcinomas, including those of the colon, lymph node, stomach, ovary, breast. CDC25A is located on chromosome 3p21 in an area frequently involved in karyotypic abnormalities in renal carcinomas, small cell carcinomas of the lung, and benign tumors of the salivary gland. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice