124720-BIOTIN

CDADC1 (Cytidine and dCMP Deaminase Domain-containing Protein 1, Testis Development Protein NYD-SP15, MGC150615, MGC41774, MGC57136, NYD-SP15, BA103J18.1) (Biotin)

Größe

£927.00

SKU:: 124720-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa423-515 from human CDADC1 (NP_112173) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1A2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: CDADC1 may play an important role in testicular development and spermatogenesis. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: KCPCDECVPLIKGAGIKQIYAGDVDVGKKKADISYMRFGELEGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGIH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.