CD93 (C1QR1, C1qRP, CDw93, ECSM3, MXRA4, C1qR(P), dJ737E23.1, Complement Component C1Q Receptor, C1q/MBL/SPA Receptor, Complement Component 1 q Subcomponent Receptor 1, Matrix-remodeling-associated Protein 4)

Größe

£685.00

SKU:: 124707
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa33-141 from C1QR1 (NP_036204) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CD93 is a 110kD O-sialoglycoprotein, known as complement C1q receptor, C1qR1, C1qRp (C1q receptor precursor), or GR11. It is expression on monocytes, granulocytes, platelets, and endothelial cells. CD93 regulates phagocytosis of apoptosis cells, and leukocyte-endothelial cell adhesion. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR* Storage and Stability: May be stored at 4°C. For long-term storage, aliquot and store at 4°C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer.