124707-APC

CD93 (Complement Component C1Q Receptor, C1q/MBL/SPA Receptor, C1qR, C1qR(p), C1qRp, CDw93, Complement Component 1 q Subcomponent Receptor 1, Matrix-remodeling-associated Protein 4, C1QR1, MXRA4) (APC)

Größe

£927.00

SKU:: 124707-APC
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa33-141 from C1QR1 (NP_036204) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3D12
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: CD93 is a 110kD O-sialoglycoprotein, known as complement C1q receptor, C1qR1, C1qRp (C1q receptor precursor), or GR11. It is expression on monocytes, granulocytes, platelets, and endothelial cells. CD93 regulates phagocytosis of apoptosis cells, and leukocyte-endothelial cell adhesion. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.