124694-ML490
CD84 (SLAM Family Member 5, Cell Surface Antigen MAX.3, Hly9-beta, Leukocyte Differentiation Antigen CD84, Signaling Lymphocytic Activation Molecule 5, SLAMF5, DKFZp781E2378) (MaxLight 490)
Größe
£914.00
- SKU:
- 124694-ML490
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa22-122 from CD84 (NP_003865) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3G10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CD84 is a 64-82kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of (preferentially on CD45RO+) T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. The antibody CD84.1.21 is able to enhance CD3 induced IFN-g production and partially block CD84-Ig binding to lymphocytes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice