124693
CD84 (SLAM Family Member 5, Cell Surface Antigen MAX.3, Hly9-beta, Leukocyte Differentiation Antigen CD84, Signaling Lymphocytic Activation Molecule 5, SLAMF5, DKFZp781E2378)
Größe
£685.00
- SKU:
- 124693
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human CD84, aa1-328 (NP_003865.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CD84 is a 64-82kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of (preferentially on CD45RO+) T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. The antibody CD84.1.21 is able to enhance CD3 induced IFN-g production and partially block CD84-Ig binding to lymphocytes. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA sequence: MAQHHLWILLLCLQTWPEAAGKDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGLLSVLAMFFLLVLILSSVFLFRLFKRRQDAASKKTIYTYIMASRNTQPAESRIYDEILQSKVLPSKEEPVNTVYSEVQFADKMGKASTQDSKPPGTSSYEIVI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice