CD83 (CD83 Antigen, CD83 Molecule, B cell Activation Protein, BL11, Cell Surface Protein HB15, HB15)

Größe

£685.00

SKU:: 124692
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-205 from CD83 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G10-1F4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: CD83 is a 45kD type I transmembrane protein. It belongs to immunoglobulin superfamily and is expressed on mature dendritic cells and activated lymphocytes. CD83 is involved in the regulation of T cell development and immune response. Soluble form CD83 has been reported to inhibit dendritic cell maturation and dendritic cell-mediated T cell proliferation. Murine CD83 ligand has been found on B cells. Applications: Suitable for use in ELISA, Immunoprecipitation and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.