CD81 (CD81 Antigen, 26kD Cell Surface Protein TAPA-1, Target of the Antiproliferative Antibody 1, Tetraspanin-28, Tspan-28, TAPA1, TSPAN28)

Größe

£685.00

SKU:: 124688
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa25-127 from CD81 (AAH02978) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B7
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: May play an important role in the regulation of lymphoma cell growth. Interacts with a 16kD Leu-13 protein to form a complex possibly involved in signal transduction. May acts a the viral receptor for HCV. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.