124688-HRP
CD81 (CD81 Antigen, 26kD Cell Surface Protein TAPA-1, Target of the Antiproliferative Antibody 1, Tetraspanin-28, Tspan-28, TAPA1, TSPAN28) (HRP)
Größe
£914.00
- SKU:
- 124688-HRP
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa25-127 from CD81 (AAH02978) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Weitere Details:
- May play an important role in the regulation of lymphoma cell growth. Interacts with a 16kD Leu-13 protein to form a complex possibly involved in signal transduction. May acts a the viral receptor for HCV. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice