124684-APC
CD79B (B Cell Antigen Receptor Complex-associated Protein beta Chain, B Cell-specific Glycoprotein B29, Ig-beta, Immunoglobulin-associated B29 Protein, B29, IGB) (APC)
Größe
£927.00
- SKU:
- 124684-APC
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant protein corresponding to aa1-229 from human CD79B with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4E10-2A10
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- The CD79 molecule, comprising two polypeptide chains, mb-1 (CD79a) and B29 (CD79b), is physically associated in the B-cell membrane with immunoglobulins to constitute the B cell antigen receptor (BCR). The CD79a/b heterodimer interacts with at least one tyrosine kinase (Lyn). Induction of tyrosine kinase activity after antigen binding causes phosphorylation of the CD79a/b dimer, and also of other molecules, thereby initiating intracellular signaling. Almost all acute lymphoblastic leukemias of precursor B cell type are positive when tested with CD79a antibodies. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice