124680
CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1)
Größe
£760.00
- SKU:
- 124680
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CD79A, aa1-226 (NP_001774.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CD79a, a 32-33KD membrane glycoprotein, is a member of Ig superfamily. It heterodimerizes with CD79b and is non-covalently cross-linked with surface Ig thus forming the BCR complex. It is expressed all stages of differentiation in mature B-cells and is required for cell surface expression and signal transduction by the BCR complex. Upon antigen binding, CD79a/b heterodimer interacts with Tyrosine kinase (Lyn) and gets phosphorylated, resulting in the inititation of intracellular signaling cascade. Pathological role of CD79a has been suggested in B-cell lymphomas and acute lymphoblastic leukemia. CD79a is often used along with CD20 in the detection of normal and neoplastic B-cells in tissue sections. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice