124676
CD70 (CD70 Antigen, CD27 Ligand, CD27L, CD27-L, CD27LG, Surface Antigen CD70, Tumor Necrosis Factor Ligand Superfamily Member 7, TNFSF7)
Größe
£685.00
- SKU:
- 124676
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human TNFSF7, aa1-193 (NP_001243).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CD70 is a 29kD type II transmembrane protein that belongs to the tumor necrosis factor (TNF) family. CD70 is expressed on a small number of activated T-cells and the majority of activated B-cells. Interaction of CD70 with its receptor, CD27, is thought to play an important role in lymphocyte activation, proliferation, survival and differentiation. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice