CD69 (Activation Inducer Molecule, AIM, BLAC/P26, CLEC2C, EA1, Early Activation Antigen CD69, Early T cell Activation Antigen p60, GP32/28, Leu23, MLR-3)

Größe

£685.00

SKU:: 124672
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa90-199 from human CD69 (AAH07037) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: The CD69 cell surface antigen, also known as activation inducer molecule (AIM), is expressed as an early activation marker on T and B lymphocytes. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.