124623
CD3E (T-cell Surface Glycoprotein CD3 epsilon Chain, T-cell Surface Antigen T3/Leu-4 epsilon Chain, T3E, CD3e)
Größe
£685.00
- SKU:
- 124623
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa23-207 from human CD3E (AAH49847.1) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4C1
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- T cell activation through the T cell antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3g, CD3d, CD3e and CD3Xi. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3e may play a role in TCR-induced growth arrest, cell survival and proliferation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice