CD39L2 (CD39 Antigen-like 2, CD39-like-2, dJ738P15.3, DKFZp781G2277, DKFZp781K21102, Ectonucleoside Triphosphate Diphosphohydrolase 6, ENTPD6, FLJ36711, IL-6SAG, Interleukin 6 Signal Transducer 2, IL6ST2, NTPDase-6)

Größe

£685.00

SKU:: 124620
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa386-484 from human ENTPD6 (NP_001238) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which is characteristic of NTPases. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.