CD32 (Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, FCGR2B, FCG2, IGFR2)

Größe

£685.00

SKU:: 124613
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa45-154 from human FCGR2B (AAH31992) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: Fcg RII, also known as CD32, is a group of three closely related proteins (Fcg RIIA, Fcg RIIB, Fcg RIIC) that share greater than 94% aa identity in their extracellular domains. They function as transmembrane receptors for the Fc portion of IgG molecules. These proteins are expressed by various hematopoietic cells including monocytes, macrophages, neutrophils, NK cells, T cells, and B cells. The Fcg RII proteins are involved in phagocytosis of immune complexes and modulation of antibody production by B cells. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice