CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103)

Größe

£685.00

SKU:: 124592
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa352-451 from human DPP4 (BC065265; AAH65265) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: CD26 is a multifunctional protein that exists as a membrane bound form and a soluble form. CD26 has three major functions including adenosine deaminase (ADA) binding, peptidase activity and extracellular matrix binding, all of which can influence T-cell proliferation and chemotaxis. It has also been shown to be involved in apoptosis. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSRELNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.