CD19 (B-lymphocyte Antigen CD19, B-lymphocyte Surface Antigen B4, Differentiation Antigen CD19, T-cell Surface Antigen Leu-12)

Größe

£685.00

SKU:: 124554
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa98-187 from human CD19 (NP_001761) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CD19 is a member of the immunoglobulin superfamily with 556aa and two immunoglobulin-like C2-type domains. As a cell surface protein, CD19 is known to form a complex with CD21, CD81 and CD225 in the membrane of mature B cells. A major function of CD19 is to assemble with the antigen receptor of B lymphocytes so as to decrease the threshold for antigen receptor dependent stimulation thus enhancing the specificity and sensitivity of B cells towards antigens. CD19 is an important protein for B cell antigen receptor signaling and regulation and also acts as a specialized adaptor protein for the amplification of Src family needed for this purpose. Regulation of growth of B cells is a major function of CD19 and its expression is confined to only B lymphocytes and follicular dendritic cells of the hematopoietic system. Increased expression of CD19 induces the production of auto-antibody thus giving an insight to the regulatory role of CD19 in autoimmunity. Defects in CD19 are a cause of hypogammaglobulinemia. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCVPPRDSLNQSLSQD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice