CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181)

Größe

£685.00

SKU:: 124549
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa21-120 from human CD177 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: The neutrophil NB1 antigen is expressed by 97% of the caucasian population. Antibodies against CD17 can be involved in neonatal alloimmune neutropenia (NAN). Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.