124549-BIOTIN

CD177 (CD177 Antigen, Human Neutrophil Alloantigen 2a, HNA-2a, NB1 Glycoprotein, NB1 GP, PRV-1, Polycythemia Rubra Vera Protein 1, NB1, PRV1, UNQ595/PRO1181) (Biotin)

Größe

£927.00

SKU:: 124549-BIOTIN
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa21-120 from human CD177 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4C4
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: The neutrophil NB1 antigen is expressed by 97% of the caucasian population. Antibodies against CD17 can be involved in neonatal alloimmune neutropenia (NAN). Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry: Formalin-fixed, paraffin-embedded sections Optimal dilutions to be determined by the researcher. AA Sequence: ALLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLW Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.