124540-PE

CD16 (CD16A, CD16a Antigen, Fc gamma R3, Fc gamma RIII alpha, Fc gamma RIII, Fc gamma RIIIa, FCRIIIA, FCGRIII, FCG3, FCGR3A, FCGR3A Protein, FcR10, FcR-10, FcRIII, FcRIIIa, IGFR3, IgG Fc Receptor III-2, Low Affinity Immunoglobulin gamma Fc Region Receptor III-A) (PE)

Größe

£914.00

SKU:: 124540-PE
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa17-254 from human FCGR3A (AAH17865) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: CD16 is a low affinity Fc receptor for immunoglobulin G. CD16 is expressed primarily on NK cells and neutrophils. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.