124536
CD153 (Tumor Necrosis Factor Ligand Superfamily Member 8, CD30 Ligand, CD30-L, CD30L, CD30LG, TNFSF8)
Größe
£685.00
- SKU:
- 124536
- Anwendung:
- WB
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human TNFSF8, aa1-234 (NP_001235.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Weitere Details:
- CD153 is a 39-40kD type II membrane glycoprotein, also known as CD30 ligand or CD30L. This TNF superfamily member is expressed on activated T cells. CD153 has been reported to stimulate B-cell proliferation, antigen-specific antibody production, polyclonal immunoglobulin secretion, and T cell activation and proliferation. This antibody inhibits binding of CD153 to CD30. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Seqeunce: MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice