CD152 (Cytotoxic T-lymphocyte Protein 4, Cytotoxic T-lymphocyte-associated Antigen 4, CTLA-4, CTLA4)

Größe

£685.00

SKU:: 124535
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa36-135 from human CTLA4 (NP_005205) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CD152, also known as Cytotoxic T-Lymphocyte Antigen 4 (CTLA-4), is a 33kD member of the immunoglobulin superfamily. It is transiently expressed on activated T cells. Regulatory T cells express high level of CTLA-4. CD152 is similar to CD28 in aa sequence, structure, and genomic organization. Whereas CD28 delivers a costimulatory signal in T cell activation, CTLA-4 negatively regulates cell-mediated immune responses through interaction with CD80 and CD86 present on antigen presenting cells (APC). CD152 is thought to play a role in the induction and maintenance of immunological tolerance, as well as the development of protective immunity and thymocyte regulation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Versandbedingungen:: Blue Ice