CD117 (CD117 Antigen, c Kit, c-Kit, KIT, Mast/stem Cell Growth Factor Receptor, PBT, Proto-oncogene Tyrosine Protein Kinase Kit, Stem Cell Factor Receptor, SCF Receptor, SCFR, v-Kit Hardy Zuckerman 4 Feline Sarcoma Viral Oncogene Homolog)

Größe

£685.00

SKU:: 124518
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa41-140 from human KIT (NP_000213) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6G12
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: KIT is the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. KIT is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in KIT are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.