CCRK (Cell Division Protein Kinase 20, Cell Cycle-related Kinase, Cyclin-kinase-activating Kinase p42, CDK-activating Kinase p42, CAK-kinase p42, Cyclin-dependent Protein Kinase H, CDK20, CDCH)

Größe

£685.00

SKU:: 124494
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa183-257 from CCRK (AAH02655) with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E11
Format:: Supplied as a liquid in PBS, pH 7.2.
Weitere Details:: CCRK contains a kinase domain most closely related to the cyclin-dependent protein kinases. This protein is involved in cell growth and activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue Thr-160. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.