124482-ML650
CCNH (Cyclin H, Cyclin-H, MO15-associated Protein, p34, p37) (MaxLight 650)
Größe
£914.00
- SKU:
- 124482-ML650
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-110 from human CCNH (AAH05280) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Weitere Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Regulated progression through the cell cycle requires sequential expression of a family of proteins called cyclins. Upon their induction, cyclins form complexes with specific cyclin-dependent kinases (CDKs), creating active holoenzymes that phosphorylate target proteins required for cell-cycle progression. In humans, the CDK/Cyclin H complex regulates the CDK-activating kinase (CAK). CAK is involved in activation of RNA polymerase II when complexed with the core-TFIIH basal transcription factor, allowing for elongation of transcripts. However, the function of the Cyclin H ortholog in zebrafish has not yet been isolated. One study has shown Cyclin H to be present throughout early stages of development, and experiments with defective Cyclin H suggest that it plays a vital role in this area. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice