CCL4L1 (C-C Motif Chemokine 4-like, Small-inducible Cytokine A4-like, Monocyte Adherence-induced Protein 5-alpha, Macrophage Inflammatory Protein 1-beta, MIP-1-beta, Lymphocyte Activation Gene 1 Protein, LAG-1, CCL4L, LAG1, SCYA4L1, CCL4L2, CCL4L, SCYA4L2)

Größe

£685.00

SKU:: 124469
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa28-92 from human CCL4L2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4G8
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: CCL4L1 is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.