124464-APC

CCL26 (CC Chemokine IMAC, Thymic Stroma Chemokine-1, TSC-1, Macrophage Inflammatory Protein 4-alpha, MIP-4-alpha, Eotaxin-3, Small-inducible Cytokine A26, C-C Motif Chemokine 26, SCYA26, UNQ216/PRO242) (APC)

Größe

£934.00

SKU:: 124464-APC
Anwendung:: WB
Reinheit:: Purified by Protein A affinity chromatography.
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Rabbit
Immunogen:: Full-length human CCL26, aa1-94 (NP_006063.1).
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Chemotactic for eosinophils and basophils. Binds to CCR3. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.