124444-BIOTIN
CCL14 (C-C Motif Chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible Cytokine A14, NCC2, SCYA14) (Biotin)
Größe
£927.00
- SKU:
- 124444-BIOTIN
- Reinheit:
- Purified by Protein A affinity chromatography.
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa20-93 from human CCL14 (AAH45165) with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1F12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- CCL14 is member of a superfamily of inducible, secreted, proinflammatory cytokines. It has weak activities on human monocytes and acts via receptors that also recognize MIP-1alpha. It also enhances the proliferation of CD34 myeloid progenitor cells. The processed form of CCL14, designated HCC-1(9-74), is a chemotactic factor that attracts monocytes, eosinophils and T cells and is a ligand for CCR1, CCR3 and CCR5. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice